PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00049914001
Common NameGSBRNA2T00049914001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 160aa    MW: 18828.7 Da    PI: 9.2641
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00049914001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57343.77.9e-141364657
               DUF573  6 lwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveK 57
                         lw+ +D +++L+G++++++++g  + +d+d fy + k+ i++++sk+ql+e 
  GSBRNA2T00049914001 13 LWNINDVLLILKGIVEYENERGFRYNSDWDIFYGYTKDLINIRFSKKQLMEE 64
                         8************************************************985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MVRRRKQQKK YLLWNINDVL LILKGIVEYE NERGFRYNSD WDIFYGYTKD LINIRFSKKQ  60
LMEEDVPLVE QKRVNDTRMD KDKSEELGGM DEFDALQDAL EASTSFQSVG KTKQKMLFQD  120
LKTLGAQRRK ELAGEWKALL NEEMELHMKK LTLLTKASL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00049914001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593965.11e-79PREDICTED: uncharacterized protein LOC106302008 isoform X2
TrEMBLA0A078FBE31e-112A0A078FBE3_BRANA; BnaC06g13230D protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14516816
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36340.12e-14DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]